SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_036228.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_036228.1.87134
Domain Number 1 Region: 6-302
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.67e-73
Family BAR domain 0.00000000052
Further Details:      
 
Domain Number 2 Region: 480-634
Classification Level Classification E-value
Superfamily PH domain-like 7.92e-27
Family Phosphotyrosine-binding domain (PTB) 0.013
Further Details:      
 
Domain Number 3 Region: 278-373
Classification Level Classification E-value
Superfamily PH domain-like 2.11e-22
Family Pleckstrin-homology domain (PH domain) 0.00000209
Further Details:      
 
Weak hits

Sequence:  NP_036228.1.87134
Domain Number - Region: 621-667
Classification Level Classification E-value
Superfamily Gam-like 0.0353
Family Gam-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_036228.1.87134
Sequence length 709
Comment DCC-interacting protein 13-alpha [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MPGIDKLPIEETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHL
TSKLLKEYEKQRFPLGGDDEVMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPITQFKE
RDLKEILTLKEVFQIASNDHDAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMH
YFCALNTLQYKKKIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREM
DSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNRNLTRKAGYLNARNKTGLVSSTWDRQ
FYFTQGGNLMSQARGDVAGGLAMDIDNCSVMAVDCEDRRYCFQITSFDGKKSSILQAESK
KDHEEWICTINNISKQIYLSENPEETAARVNQSALEAVTPSPSFQQRHESLRPAAGQSRP
PTARTSSSGSLGSESTNLAALSLDSLVAPDTPIQFDIISPVCEDQPGQAKAFGQGGRRTN
PFGESGGSTKSETEDSILHQLFIVRFLGSMEVKSDDHPDVVYETMRQILAARAIHNIFRM
TESHLLVTCDCLKLIDPQTQVTRLTFPLPCVVLYATHQENKRLFGFVLRTSSGRSESNLS
SVCYIFESNNEGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELNKQKQIE
KDLEEQSRLIAASSRPNQASSEGQFVVLSSSQSEESDLGEGGKKRESEA
Download sequence
Identical sequences H2QMU0 Q9UKG1
gi|6912242|ref|NP_036228.1| ENSNLEP00000008854 9598.ENSPTRP00000025987 9606.ENSP00000288266 NP_036228.1.87134 NP_036228.1.92137 XP_001173707.1.37143 XP_004087926.1.23891 ENSP00000288266 ENSNLEP00000008854 ENSP00000288266 ENSPTRP00000025987 ENSP00000288266 GO.78633 HR3450 hso003007272.2 ENSPTRP00000025987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]