SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_036436.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_036436.1.87134
Domain Number 1 Region: 167-482
Classification Level Classification E-value
Superfamily RNI-like 6.08e-47
Family Cyclin A/CDK2-associated p19, Skp2 0.0062
Further Details:      
 
Domain Number 2 Region: 107-157
Classification Level Classification E-value
Superfamily F-box domain 2.49e-17
Family F-box domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_036436.1.87134
Sequence length 491
Comment F-box/LRR-repeat protein 7 isoform 1 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MGANNGKQYGSEGKGSSSISSDVSSSTDHTPTKAQKNVATSEDSDLSMRTLSTPSPALIC
PPNLPGFQNGRGSSTSSSSITGETVAMVHSPPPTRLTHPLIRLASRPQKEQASIDRLPDH
SMVQIFSFLPTNQLCRCARVCRRWYNLAWDPRLWRTIRLTGETINVDRALKVLTRRLCQD
TPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNL
EHLDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQL
THLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHC
GRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGL
ECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCEVSVEALRFVKRHCKR
CVIEHTNPAFF
Download sequence
Identical sequences A0A2I3LVV3 A0A2K5P535 A0A2K5X7E7 A0A2K5ZAB4 A0A2K6AVU3 H2QQN9 H9EQ79 Q9UJT9
NP_001253669.1.72884 NP_036436.1.87134 NP_036436.1.92137 XP_001148598.1.37143 XP_003821989.1.60992 XP_005556667.1.63531 XP_011757634.1.29376 XP_011849573.1.47321 XP_011915835.1.92194 ENSP00000423630 ENSP00000423630 ENSP00000329632 gi|6912466|ref|NP_036436.1| ENSPTRP00000028725 ENSPTRP00000028725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]