SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_036465.2.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_036465.2.87134
Domain Number - Region: 45-90
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.00209
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_036465.2.87134
Sequence length 103
Comment C-Myc-binding protein [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENP
EIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
Download sequence
Identical sequences A0A0D9S7Q0 A0A2K6U5Y7 F7GS32 G7NUB6 H0XJ67 H2PYQ5 Q99417
ENSOGAP00000016157 ENSP00000380702 ENSPTRP00000000986 ENSPTRP00000000986 9606.ENSP00000380702 ENSMMUP00000040415 NP_036465.2.87134 NP_036465.2.92137 XP_003415559.1.64505 XP_003799049.2.62490 XP_004371974.1.4749 XP_008149382.1.99482 XP_010344754.1.74449 GO.33777 ENSGGOP00000005689 gi|57242777|ref|NP_036465.2| ENSOGAP00000016157 ENSP00000380702 ENSGGOP00000005689 ENSP00000380702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]