SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_036742.2.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_036742.2.4139
Domain Number 1 Region: 336-417
Classification Level Classification E-value
Superfamily DEATH domain 1.62e-22
Family DEATH domain, DD 0.00000688
Further Details:      
 
Domain Number 2 Region: 86-124
Classification Level Classification E-value
Superfamily TNF receptor-like 2.59e-16
Family TNF receptor-like 0.0001
Further Details:      
 
Domain Number 3 Region: 32-84
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000565
Family TNF receptor-like 0.0000717
Further Details:      
 
Domain Number 4 Region: 125-166
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000127
Family TNF receptor-like 0.000089
Further Details:      
 
Domain Number 5 Region: 167-190
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000968
Family TNF receptor-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_036742.2.4139
Sequence length 425
Comment tumor necrosis factor receptor superfamily member 16 precursor [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MRRAGAACSAMDRLRLLLLLILGMSSGGAKETCSTGLYTHSGECCKACNLGEGVAQPCGA
NQTVCEPCLDSVTFSDVVSATEPCKPCTECLGLQSMSAPCVEADDAVCRCAYGYYQDEET
GHCEACSVCEVGSGLVFSCQDKQNTVCEECPEGTYSDEANHVDPCLPCTVCEDTERQLRE
CTPWADAECEEIPGRWIPRSTPPEGSDSTAPSTQEPEVPPEQDLVPSTVADMVTTVMGSS
QPVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGE
KLHSDSGISVDSQSLHDQQTHTQTASGQALKGDGNLYSSLPLTKREEVEKLLNGDTWRHL
AGELGYQPEHIDSFTHEACPVRALLASWGAQDSATLDALLAALRRIQRADIVESLCSEST
ATSPV
Download sequence
Identical sequences G3V6P1
NP_036742.2.100692 NP_036742.2.4139 10116.ENSRNOP00000007268 ENSRNOP00000007268 ENSRNOP00000007268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]