SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_037295.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_037295.1.100692
Domain Number 1 Region: 119-179
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000125
Family Complement control module/SCR domain 0.0000912
Further Details:      
 
Domain Number 2 Region: 23-77
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000324
Family Complement control module/SCR domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_037295.1.100692
Sequence length 267
Comment interleukin-2 receptor subunit alpha precursor [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MEPHLLMLGFLSFTIVPGCWAELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLNE
LVYMACLGNSWSNNCQCTSNSHDNSREQVTPQPEGQKEQQTTDTQKSTQSVYQENLAGHC
REPPPWRHEDTKRIYHFVEGQIVLYTCIQGYKALQRGPAISICKTVCGEIRWTHPQLTCV
DEKEHHQFLASEESQGSRNSFPESEASCPTPNTDFSQLTEATTTMETFVFTKEYQVAVAS
CIFLLLSILLLSGFTWQHRWRKSRRTI
Download sequence
Identical sequences P26897
NP_037295.1.100692 NP_037295.1.4139 ENSRNOP00000066383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]