SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_038671.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_038671.2.92730
Domain Number 1 Region: 245-533
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.02e-87
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_038671.2.92730
Sequence length 541
Comment tyrosine-protein phosphatase non-receptor type 5 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MCCSERLLGLPQPVEMEAPDEAEGLPSKQKEMPPPPPPSPPSEPAQKLPPQGAGSHSLTV
RSSLCLFAASQFLLACGVLWLSGHGHSWLQNTTDLISSSLTVLNHLGPVAWLGSGTWGIP
SLLLVSLTVSLVIVTTLVWHLLKAPPEPPAPLPPEDRRQSVSRQPSFTYSEWMEEKVEDD
FLDLDAVPETPVFDCVMDIKPETDPASLTVKSMGLQERRGSNVSLTLDMCTPGCNEEGFG
YLVSPREESAHEYLLSASRVLRAEELHEKALDPFLLQAEFFEIPMNFVDPKEYDIPGLVR
KNRYKTILPNPHSRVRLTSPDPEDPLSSYINANYIRGYSGEEKVYIATQGPIVSTVADFW
RMVWQERTPIIVMITNIEEMNEKCTEYWPEEQVVHDGVEITVQKVIHTEDYRLRLISLRR
GTEERSLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCSPIIVHCSAGIGRTG
CFIATSICCQQLRREGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHAMSLYEKQLSLQSS
E
Download sequence
Identical sequences P54830
10090.ENSMUSP00000099686 ENSMUSP00000033142 NP_001157037.1.92730 NP_038671.2.92730 XP_006540776.1.92730 XP_006540777.1.92730 XP_006540778.1.92730 XP_017177535.1.92730 ENSMUSP00000033142 ENSMUSP00000033142 ENSMUSP00000099686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]