SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_046804.1.13413 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_046804.1.13413
Domain Number 1 Region: 1715-2169
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.98e-112
Family RNA-dependent RNA-polymerase 0.0000186
Further Details:      
 
Domain Number 2 Region: 31-278
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 8.15e-50
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.006
Further Details:      
 
Domain Number 3 Region: 260-535
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 5.09e-43
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0097
Further Details:      
 
Domain Number 4 Region: 557-755
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.24e-27
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.061
Further Details:      
 
Domain Number 5 Region: 1514-1700
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.8e-27
Family Viral cysteine protease of trypsin fold 0.02
Further Details:      
 
Domain Number 6 Region: 1149-1305
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000914
Family Nucleotide and nucleoside kinases 0.072
Further Details:      
 
Weak hits

Sequence:  NP_046804.1.13413
Domain Number - Region: 926-1149,1367-1477
Classification Level Classification E-value
Superfamily ARM repeat 0.0443
Family Mo25 protein 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_046804.1.13413
Sequence length 2179
Comment polyprotein [Human parechovirus]; AA=GCF_000861505.1; RF=na; TAX=195054; STAX=195054; NAME=Human parechovirus; strain=Gregory; AL=Complete Genome; RT=Major
Sequence
METIKSIADMATGVTKTIDATINSVNEIITNTDNASGGDILTKVADDASNILGPNCYATT
SEPENKDVVQATTTVNTTNLTQHPSAPTLPFTPDFSNVDTFHSMAYDTTTGSKNPNKLVR
LTTHAWASTLQRGHQIDHVNLPVDFWDEQRKPAYGHAKYFAAVRCGFHFQVQVNVNQGTA
GSALVVYEPKPVVDYDKDLEFGAFTNLPHVLMNLAETTQADLCIPYVADTNYVKTDSSDL
GQLKVYVWTPLSIPSGSSNQVDVTILGSLLQLDFQNPRVYGQNVDIYDTAPSKPIPLRKT
KYLTMSTKYKWTRNKVDIAEGPGSMNMANVLSTTAAQSVALVGERAFYDPRTAGSKSRFD
DLVKISQLFSVMADSTTPSANHGIDQKGYFKWSANSDPQAIVHRNLVHLNLFPNLKVFEN
SYSYFRGSLIIRLSVYASTFNRGRLNGFFPNSSTDETSEIDNAIYTICDIGSDNSFEITI
PYSFSTWMRKTHGKPIGLFQIEVLNRLTYNYSSPNEVYCIVQGKMGQDAKFFCPTGSLVT
FQNSWGSQMDLTDPLCIEDSVEDCKQTITPTELGLTSAQDDGPLGNDKPNYFLNFKSMNV
DIFTVSHTKVDNIFGRAWFAHVHDFTNDGLWRQGLEFPKEGHGALSLLFAYFTGELNIHV
LFLSDRGFLRVGHTYDTETNRTNFLSSSGIITVPAGEQMTLSVPSYSNKPLRTVRSSNAL
GYLLCKPLLTGTSSGRIEIFLSLRCPNFFFPLPAPKPATRKYRGDLATWSDQSPYGRQGK
KQLMKLAYLDRGFYKHYGIVVGDDVYQLDSDDIFKTALTGKAKFTKTRLTPDWVVEEECE
LDYFRIKYLESSVNSEHIFSVDNNCETIAKDIFGSHSLSQHQQIGLIGTILLTAGLMSTI
KTPVNPTTIKEFFNHAIEGDEQGLSLLVQKCTTFFSSAATELLDNDLVKFIIKILVRILC
YMVLYCHKPNILTTACLSTLLVMDVTSSSVLSPSCKALMQCLMDGDVKKLAEVVAESMSN
TDDDEIKEQICDTVKYTKQILSNQGPFKGFNEISTAFRHIDWWIQTLLKIKDMVLSVFKP
SVEKRAVEWLERNKEHVCSILDYASDIIVKSKDQTKMKTQEFYQRYNDCLSKFKPIMAMC
FRSCHNSISNTVYRLFQELARIPNRMATQNDLIRVEPIGIWIQGEPGQGKSFLTHTLSKQ
LQKTCGLQGIYTNPTASEFMDGYDNQDIHLIDDLGQTRKERDIEMLCNCISSDPDIVPMA
HLEEKGKFYTSKLVIATTNKPDFSSTVLLDSGALRRRFPYIMHIRAAKHYSKSGKLNVSQ
AMPHMSTGECWEVSKNGRDWETLKLKELIDKITVDYKERIANYNTWKKQLEDQTLDDLDD
AVSYIKHNYPDAIPYIDEYLNIEMSTLIEQMEAFIEPKPSVFKCFASRVGDKIKEASREV
VKWFSDKLKSMLNFVERNKAWLTVVSAVTSAIGILLLVTKIFKKEESKDERAYNPTLPVA
KPKGTFPVSQREFKNEAPYDGQLEHIISQMAYITGSTTGHITHCAGYQHDEIILHGHSIK
YLEQEEELTLHYKNKVFPIEQPSVTQVTLGGKPMDLAIVKCKLPFRFKKNSKYYTNKIGT
ESMLIWMTEQGIITKEVQRVHHSGGIKTREGTESTKTISYTVKSCKGMCGGLLISKVEGN
FKILGMHIAGNGEMGVAIPFNFLKNDMSDQGIVTEVTPIQPMYINTKSQIHKSPVYGAVE
VKMGPAVLSKSDTRLEEPVDCLVKKSASKYRVNKFQVNNELWQGVKACVKSKFREIFGVN
GIVDMKTAILGTSHVNSMDLSTSAGYSFVKSGYKKKDLICLEPFSVSPMLEKLVQEKFHN
LLKGNQITTIFNTCLKDELRKLDKIATGKTRCIEACEIDYCIVYRMIMMEIYDKIYQTPC
YYSGLAVGINPYRDWHFMINALNDYNYEMDYSQYDGSLSSMLLWEAVQVLAYCHDSPDLV
MQLHKPVIDSDHVVFNERWLIHGGMPSGSPCTTVLNSLCNLMMCIYTTNLISPGIDCLPI
VYGDDVILSLDKEIEPERLQSIMAESFGAEVTGSRKDEPPSLKPRMEVEFLKRKPGYFPE
STFIVGKLDTENMIQHLMWMKNFSTFKQQLQSYLMELCLHGKDTYQHYVKILNPYLKEWN
IPVDDYEVVIGKLVPMVFD
Download sequence
Identical sequences O73556
POLG_EC23W gi|9630377|ref|NP_046804.1| NP_046804.1.13413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]