SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_054730.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_054730.1.92137
Domain Number 1 Region: 370-474
Classification Level Classification E-value
Superfamily SH2 domain 6.33e-26
Family SH2 domain 0.00000133
Further Details:      
 
Domain Number 2 Region: 482-523
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000981
Family SOCS box-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_054730.1.92137
Sequence length 536
Comment suppressor of cytokine signaling 5 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MDKVGKMWNNFKYRCQNLFGHEGGSRSENVDMNSNRCLSVKEKNISIGDSTPQQQSSPLR
ENIALQLGLSPSKNSSRRNQNCATEIPQIVEISIEKDNDSCVTPGTRLARRDSYSRHAPW
GGKKKHSCSTKTQSSLDADKKFGRTRSGLQRRERRYGVSSVHDMDSVSSRTVGSRSLRQR
LQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPV
SPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLG
PKLAPGMTEISGDSSAIPQANCDSEEDTTTLCLQSRRQKQRQISGDSHTHVSRQGAWKVH
TQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFR
RYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTF
PFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK
Download sequence
Identical sequences H2RII6 O75159
ENSPTRP00000061344 NP_054730.1.87134 NP_054730.1.92137 NP_659198.1.87134 NP_659198.1.92137 XP_003822711.1.60992 XP_014199308.1.60992 XP_016803969.1.37143 XP_016803970.1.37143 ENSPTRP00000061344 9598.ENSPTRP00000042617 9606.ENSP00000305133 HR6385 gi|21618354|ref|NP_659198.1| gi|7662240|ref|NP_054730.1| ENSP00000305133 ENSP00000305133 ENSP00000378330 ENSP00000305133 ENSP00000378330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]