SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_055951.2.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_055951.2.92137
Domain Number 1 Region: 2208-2301
Classification Level Classification E-value
Superfamily C-type lectin-like 1.79e-32
Family Link domain 0.00011
Further Details:      
 
Domain Number 2 Region: 508-646
Classification Level Classification E-value
Superfamily FAS1 domain 1.44e-30
Family FAS1 domain 0.0015
Further Details:      
 
Domain Number 3 Region: 1472-1520,1601-1712
Classification Level Classification E-value
Superfamily FAS1 domain 3.92e-28
Family FAS1 domain 0.003
Further Details:      
 
Domain Number 4 Region: 1714-1867
Classification Level Classification E-value
Superfamily FAS1 domain 2.49e-26
Family FAS1 domain 0.0039
Further Details:      
 
Domain Number 5 Region: 964-1121
Classification Level Classification E-value
Superfamily FAS1 domain 1.31e-22
Family FAS1 domain 0.0046
Further Details:      
 
Domain Number 6 Region: 385-498
Classification Level Classification E-value
Superfamily FAS1 domain 1.7e-20
Family FAS1 domain 0.0037
Further Details:      
 
Domain Number 7 Region: 2299-2462
Classification Level Classification E-value
Superfamily FAS1 domain 3.01e-17
Family FAS1 domain 0.01
Further Details:      
 
Domain Number 8 Region: 1139-1230
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000000641
Family FAS1 domain 0.0084
Further Details:      
 
Domain Number 9 Region: 1544-1581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family Merozoite surface protein 1 (MSP-1) 0.065
Further Details:      
 
Weak hits

Sequence:  NP_055951.2.92137
Domain Number - Region: 904-960
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000812
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 2009-2137
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000957
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 198-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00102
Family Merozoite surface protein 1 (MSP-1) 0.039
Further Details:      
 
Domain Number - Region: 1369-1501
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00129
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 829-861
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00261
Family EGF-like domain of nidogen-1 0.072
Further Details:      
 
Domain Number - Region: 1968-2009
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00395
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 863-911
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00593
Family EGF-like domain of nidogen-1 0.078
Further Details:      
 
Domain Number - Region: 230-283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0077
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 2140-2176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00977
Family EGF-like domain of nidogen-1 0.072
Further Details:      
 
Domain Number - Region: 109-152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0519
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 728-771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0774
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_055951.2.92137
Sequence length 2570
Comment stabilin-1 precursor [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MAGPRGLLPLCLLAFCLAGFSFVRGQVLFKGCDVKTTFVTHVPCTSCAAIKKQTCPSGWL
RELPDQITQDCRYEVQLGGSMVSMSGCRRKCRKQVVQKACCPGYWGSRCHECPGGAETPC
NGHGTCLDGMDRNGTCVCQENFRGSACQECQDPNRFGPDCQSVCSCVHGVCNHGPRGDGS
CLCFAGYTGPHCDQELPVCQELRCPQNTQCSAEAPSCRCLPGYTQQGSECRAPNPCWPSP
CSLLAQCSVSPKGQAQCHCPENYHGDGMVCLPKDPCTDNLGGCPSNSTLCVYQKPGQAFC
TCRPGLVSINSNASAGCFAFCSPFSCDRSATCQVTADGKTSCVCRESEVGDGRACYGHLL
HEVQKATQTGRVFLQLRVAVAMMDQGCREILTTAGPFTVLVPSVSSFSSRTMNASLAQQL
CRQHIIAGQHILEDTRTQQTRRWWTLAGQEITVTFNQFTKYSYKYKDQPQQTFNIYKANN
IAANGVFHVVTGLRWQAPSGTPGDPKRTIGQILASTEAFSRFETILENCGLPSILDGPGP
FTVFAPSNEAVDSLRDGRLIYLFTAGLSKLQELVRYHIYNHGQLTVEKLISKGRILTMAN
QVLAVNISEEGRILLGPEGVPLQRVDVMAANGVIHMLDGILLPPTILPILPKHCSEEQHK
IVAGSCVDCQALNTSTCPPNSVKLDIFPKECVYIHDPTGLNVLKKGCASYCNQTIMEQGC
CKGFFGPDCTQCPGGFSNPCYGKGNCSDGIQGNGACLCFPDYKGIACHICSNPNKHGEQC
QEDCGCVHGLCDNRPGSGGVCQQGTCAPGFSGRFCNESMGDCGPTGLAQHCHLHARCVSQ
EGVARCRCLDGFEGDGFSCTPSNPCSHPDRGGCSENAECVPGSLGTHHCTCHKGWSGDGR
VCVAIDECELDMRGGCHTDALCSYVGPGQSRCTCKLGFAGDGYQCSPIDPCRAGNGGCHG
LATCRAVGGGQRVCTCPPGFGGDGFSCYGDIFRELEANAHFSIFYQWLKSAGITLPADRR
VTALVPSEAAVRQLSPEDRAFWLQPRTLPNLVRAHFLQGALFEEELARLGGQEVATLNPT
TRWEIRNISGRVWVQNASVDVADLLATNGVLHILSQVLLPPRGDVPGGQGLLQQLDLVPA
FSLFRELLQHHGLVPQIEAATAYTIFVPTNRSLEAQGNSSHLDADTVRHHVVLGEALSME
TLRKGGHRNSLLGPAHWIVFYNHSGQPEVNHVPLEGPMLEAPGRSLIGLSGVLTVGSSRC
LHSHAEALREKCVNCTRRFRCTQGFQLQDTPRKSCVYRSGFSFSRGCSYTCAKKIQVPDC
CPGFFGTLCEPCPGGLGGVCSGHGQCQDRFLGSGECHCHEGFHGTACEVCELGRYGPNCT
GVCDCAHGLCQEGLQGDGSCVCNVGWQGLRCDQKITSPQCPRKCDPNANCVQDSAGASTC
ACAAGYSGNGIFCSEVDPCAHGHGGCSPHANCTKVAPGQRTCTCQDGYMGDGELCQEINS
CLIHHGGCHIHAECIPTGPQQVSCSCREGYSGDGIRTCELLDPCSKNNGGCSPYATCKST
GDGQRTCTCDTAHTVGDGLTCRARVGLELLRDKHASFFSLRLLEYKELKGDGPFTIFVPH
ADLMSNLSQDELARIRAHRQLVFRYHVVGCRRLRSEDLLEQGYATALSGHPLRFSEREGS
IYLNDFARVVSSDHEAVNGILHFIDRVLLPPEALHWEPDDAPIPRRNVTAAAQGFGYKIF
SGLLKVAGLLPLLREASHRPFTMLWPTDAAFRALPPDRQAWLYHEDHRDKLAAILRGHMI
RNVEALASDLPNLGPLRTMHGTPISFSCSRTRAGELMVGEDDARIVQRHLPFEGGLAYGI
DQLLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQGSPEACWRFYPKFWTSPP
LHSLGLRSVWVHPSLWGRPQGLGRGCHRNCVTTTWKPSCCPGHYGSECQACPGGPSSPCS
DRGVCMDGMSGSGQCLCRSGFAGTACELCAPGAFGPHCQACRCTVHGRCDEGLGGSGSCF
CDEGWTGPRCEVQLELQPVCTPPCAPEAVCRAGNSCECSLGYEGDGRVCTVADLCQDGHG
GCSEHANCSQVGTMVTCTCLPDYEGDGWSCRARNPCTDGHRGGCSEHANCLSTGLNTRRC
ECHAGYVGDGLQCLEESEPPVDRCLGQPPPCHSDAMCTDLHFQEKRAGVFHLQATSGPYG
LNFSEAEAACEAQGAVLASFPQLSAAQQLGFHLCLMGWLANGSTAHPVVFPVADCGNGRV
GIVSLGARKNLSERWDAYCFRVQDVACRCRNGFVGDGISTCNGKLLDVLAATANFSTFYG
MLLGYANATQRGLDFLDFLDDELTYKTLFVPVNEGFVDNMTLSGPDLELHASNATLLSAN
ASQGKLLPAHSGLSLIISDAGPDNSSWAPVAPGTVVVSRIIVWDIMAFNGIIHALASPLL
APPQPQAVLAPEAPPVAAGVGAVLAAGALLGLVAGALYLRARGKPMGFGFSAFQAEDDAD
DDFSPWQEGTNPTLVSVPNPVFGSDTFCEPFDDSLLEEDFPDTQRILTVK
Download sequence
Identical sequences Q9NY15
ENSP00000312946 9606.ENSP00000312946 ENSP00000312946 ENSP00000312946 gi|61743978|ref|NP_055951.2| NP_055951.2.87134 NP_055951.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]