SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_057256.2.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_057256.2.87134
Domain Number 1 Region: 168-242
Classification Level Classification E-value
Superfamily UBA-like 2.43e-18
Family UBA domain 0.0028
Further Details:      
 
Domain Number 2 Region: 8-96
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000266
Family Ubiquitin-related 0.012
Further Details:      
 
Domain Number 3 Region: 279-329
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000836
Family UBA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_057256.2.87134
Sequence length 405
Comment ubiquitin-associated domain-containing protein 1 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MFVQEEKIFAGKVLRLHICASDGAEWLEEATEDTSVEKLKERCLKHCAHGSLEDPKSITH
HKLIHAASERVLSDARTILEENIQDQDVLLLIKKRAPSPLPKMADVSAEEKKKQDQKAPD
KEAILRATANLPSYNMDRAAVQTNMRDFQTELRKILVSLIEVAQKLLALNPDAVELFKKA
NAMLDEDEDERVDEAALRQLTEMGFPENRATKALQLNHMSVPQAMEWLIEHAEDPTIDTP
LPGQAPPEAEGATAAASEAAAGASATDEEARDELTEIFKKIRRKREFRADARAVISLMEM
GFDEKEVIDALRVNNNQQNAACEWLLGDRKPSPEELDKGIDPDSPLFQAILDNPVVQLGL
TNPKTLLAFEDMLENPLNSTQWMNDPETGPVMLQISRIFQTLNRT
Download sequence
Identical sequences A0A140VK64 Q9BSL1
GO.35453 ENSP00000360821 ENSP00000360821 ENSP00000360821 NP_057256.2.87134 NP_057256.2.92137 gi|55770884|ref|NP_057256.2| 9606.ENSP00000360821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]