SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_057630.2.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_057630.2.92137
Domain Number 1 Region: 228-483
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.46e-63
Family Eukaryotic proteases 0.000000129
Further Details:      
 
Domain Number 2 Region: 46-163
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-22
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 3 Region: 190-236
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000079
Family Complement control module/SCR domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_057630.2.92137
Sequence length 487
Comment complement C1r subcomponent-like protein isoform 1 precursor [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MPGPRVWGKYLWRSPHSKGCPGAMWWLLLWGVLQACPTRGSVLLAQELPQQLTSPGYPEP
YGKGQESSTDIKAPEGFAVRLVFQDFDLEPSQDCAGDSVTISFVGSDPSQFCGQQGSPLG
RPPGQREFVSSGRSLRLTFRTQPSSENKTAHLHKGFLALYQTVAVNYSQPISEASRGSEA
INAPGDNPAKVQNHCQEPYYQAAAAGALTCATPGTWKDRQDGEEVLQCMPVCGRPVTPIA
QNQTTLGSSRAKLGNFPWQAFTSIHGRGGGALLGDRWILTAAHTIYPKDSVSLRKNQSVN
VFLGHTAIDEMLKLGNHPVHRVVVHPDYRQNESHNFSGDIALLELQHSIPLGPNVLPVCL
PDNETLYRSGLLGYVSGFGMEMGWLTTELKYSRLPVAPREACNAWLQKRQRPEVFSDNMF
CVGDETQRHSVCQGDSGSVYVVWDNHAHHWVATGIVSWGIGCGEGYDFYTKVLSYVDWIK
GVMNGKN
Download sequence
Identical sequences Q9NZP8
gi|289547636|ref|NP_057630.2| 9606.ENSP00000266542 ENSP00000266542 ENSP00000266542 NP_057630.2.87134 NP_057630.2.92137 ENSP00000266542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]