SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_058038.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_058038.2.92730
Domain Number 1 Region: 50-188
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.16e-37
Family Regulator of G-protein signaling, RGS 0.0000935
Further Details:      
 
Domain Number 2 Region: 359-461
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-34
Family Ras-binding domain, RBD 0.00000675
Further Details:      
 
Domain Number 3 Region: 303-372
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.94e-20
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_058038.2.92730
Sequence length 547
Comment regulator of G-protein signaling 14 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MPGKPKHLGVPNGRMVLAVSDGELTSTAGSQAQGEGRGSSLSIHSLPSGPSSPFSTEEQP
VASWAQSFERLLQDPRGLAYFTEFLKKEFSAENVTFWKACERFQQIPASDTKQLAQEAHN
IYHEFLSSQALSPVNIDRQAWLSEEVLAQPRPDMFRAQQLQIFNLMKFDSYARFVKSPLY
QECLLAEAEGRPLREPGSSHLGSPDTARKKPKLKPGKSLPLGVEELGQLPLAEGPCGRPL
RKSFRREMTGGAMNSALRRESQGSLNSSASLDLGFLAFVSSKSESHRKSLGSGESESESR
PGKYCCVYLPDGTASLALARPGLTIRDMLAGICEKRGLSLPDIKVYLVGNEQKALVLDQD
CTVLADQEVRLENRITFQLELVGLERVVRISAKPTKRLQEALQPILAKHGLSLDQVVLHR
PGEKQPMDLENPVSSVASQTLVLDTPPDAKMSEARSISPCRSQGCLPRTQTKDSHLPPSS
SSLLVEDASSSTGNRQTCDIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQLPSQRP
GSREAPP
Download sequence
Identical sequences P97492
ENSMUSP00000068731 ENSMUSP00000068731 ENSMUSP00000068731 10090.ENSMUSP00000068731 NP_058038.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]