SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_060291.2.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_060291.2.92137
Domain Number 1 Region: 68-264
Classification Level Classification E-value
Superfamily Rhomboid-like 3.27e-34
Family Rhomboid-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_060291.2.92137
Sequence length 303
Comment rhomboid-related protein 2 isoform 2 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MAAVHDLEMESMNLNMGREMKEELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRG
TYLERANCFPPPVFIISISLAELAVFIYYAVWKPQKQWITLDTGILESPFIYSPEKREEA
WRFISYMLVHAGVQHILGNLCMQLVLGIPLEMVHKGLRVGLVYLAGVIAGSLASSIFDPL
RYLVGASGGVYALMGGYFMNVLVNFQEMIPAFGIFRLLIIILIIVLDMGFALYRRFFVPE
DGSPVSFAAHIAGGFAGMSIGYTVFSCFDKALLKDPRFWIAIAAYLACVLFAVFFNIFLS
PAN
Download sequence
Identical sequences G3R248 H2N7W6 H2PYQ6 Q9NX52
9598.ENSPTRP00000000988 9600.ENSPPYP00000001748 9606.ENSP00000289248 gi|54144654|ref|NP_060291.2| ENSPPYP00000001748 ENSP00000289248 ENSP00000362081 ENSP00000289248 ENSP00000362081 ENSPPYP00000001748 NP_060291.2.87134 NP_060291.2.92137 XP_009250532.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]