SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_061919.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_061919.1.87134
Domain Number 1 Region: 36-331
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.54e-63
Family Ankyrin repeat 0.000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_061919.1.87134
Sequence length 361
Comment ankyrin repeat domain-containing protein 16 isoform a [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MAQPGDPRRLCRLVQEGRLRALKEELQAAGGCPGPAGDTLLHCAARHGHRDVLAYLAEAW
GMDIEATNRDYKRPLHEAASMGHRDCVRYLLGRGAAVDCLKKADWTPLMMACTRKNLGVI
QELVEHGANPLLKNKDGWNSFHIASREGDPLILQYLLTVCPGAWKTESKIRRTPLHTAAM
HGHLEAVKVLLKRCQYEPDYRDNCGVTALMDAIQCGHIDVARLLLDEHGACLSAEDSLGA
QALHRAAVTGQDEAIRFLVSELGVDVDVRATSTHLTALHYAAKEGHTSTIQTLLSLGADI
NSKDEKNRSALHLACAGQHLACAKFLLQSGLKDSEDITGTLAQQLPRRADVLQGSGHSAM
T
Download sequence
Identical sequences A0A2I2YYT5 Q6P6B7
ENSP00000369434 ENSP00000369436 NP_001009941.1.87134 NP_001009941.1.92137 NP_061919.1.87134 NP_061919.1.92137 XP_004049072.1.27298 XP_018890360.1.27298 ENSP00000369434 ENSP00000369436 9606.ENSP00000369434 gi|58331111|ref|NP_061919.1| gi|58331113|ref|NP_001009941.1| ENSGGOP00000012992 ENSP00000352361 ENSGGOP00000012992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]