SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_062051.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_062051.1.4139
Domain Number 1 Region: 663-813
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.2e-37
Family Toll/Interleukin receptor TIR domain 0.0000552
Further Details:      
 
Domain Number 2 Region: 396-632
Classification Level Classification E-value
Superfamily L domain-like 3.4e-36
Family Ngr ectodomain-like 0.023
Further Details:      
 
Domain Number 3 Region: 32-254
Classification Level Classification E-value
Superfamily L domain-like 7.18e-34
Family Ngr ectodomain-like 0.02
Further Details:      
 
Weak hits

Sequence:  NP_062051.1.4139
Domain Number - Region: 267-408
Classification Level Classification E-value
Superfamily L domain-like 0.000112
Family Internalin LRR domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_062051.1.4139
Sequence length 835
Comment toll-like receptor 4 precursor [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MMPLLHLAGTLIMALFLSCLRPGSLNPCIEVLPNITYQCMDQNLSKIPHDIPYSTKNLDL
SFNPLKILRSYSFTNFSQLQWLDLSRCEIETIEDKAWHGLNQLSTLVLTGNPIKSFSPGS
FSGLTNLENLVAVETKMTSLEGFHIGQLISLKKLNVAHNLIHSFKLPEYFSNLTNLEHVD
LSYNYIQTISVKDLQFLRENPQVNLSLDLSLNPIDSIQAQAFQGIRLHELTLRSNFNSSN
VLKMCLQNMTGLHVHRLILGEFKNERNLESFDRSVMEGLCNVSIDEFRLTYINHFSDDIY
NLNCLANISAMSFTGVHIKHIADVPRHFKWQSLSIIRCHLKPFPKLSLPFLKSWTLTTNR
EDISFGQLALPSLRYLDLSRNAMSFRGCCSYSDFGTNNLKYLDLSFNGVILMSANFMGLE
ELEYLDFQHSTLKKVTEFSVFLSLEKLLYLDISYTNTKIDFDGIFLGLISLNTLKMAGNS
FKDNTLSNVFTNTTNLTFLDLSKCQLEQISRGVFDTLYRLQLLNMSHNNLLFLDPSHYKQ
LYSLRTLDCSFNRIETSKGILQHFPKSLAVFNLTNNSVACICEYQNFLQWVKDQKMFLVN
VEQMKCASPIDMKASLVLDFTNSTCYIYKTIISVSVVSVLVVATVAFLIYHFYFHLILIA
GCKKYSRGESIYDAFVIYSSQNEDWVRNELVKNLEEGVPRFQLCLHYRDFIPGVAIAANI
IQEGFHKSRKVIVVVSRHFIQSRWCIFEYEIAQTWQFLSSRSGIIFIVLEKVEKSLLRQQ
VELYRLLSRNTYLEWEDNALGRHIFWRRLKKALLDGKALNPDETSEEEQEATTLT
Download sequence
Identical sequences Q9QX05
NP_062051.1.100692 NP_062051.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]