SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_062625.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_062625.2.92730
Domain Number 1 Region: 293-576
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.44e-105
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000268
Further Details:      
 
Domain Number 2 Region: 87-262
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.05e-35
Family CRAL/TRIO domain 0.0004
Further Details:      
 
Domain Number 3 Region: 3-82
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.000000000000353
Family CRAL/TRIO N-terminal domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_062625.2.92730
Sequence length 593
Comment tyrosine-protein phosphatase non-receptor type 9 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MEPATAPRPDMAPELTPEEEQATKQFLEEINKWTVQYNVSPLSWNVAVKFLMARKFDVLR
AVELFHCYRETRRKEGIVKLKPHEEPLRSEILSGKFTILNVRDPTGASIALFTARLHHPH
KSAQHVVLQALFYLLDRAVDSFETQRNGLVFIYDMCGSNYANFELDLGKKVLNLLKGAFP
ARLKKVLIVGAPIWFRVPYSIISLLLKDKVRERIQILKTSEVTQHLPRECLPENLGGYVK
IDLATWNFQFLPQVNGHPDPFDEIILSSLPPALDWDSVHVPGPHAMTIQELVDYVNTRQK
RGIYEEYEDIRRENPVGTFHCSMSPGNLEKNRYGDVPCLDQTRVKLTKRSGHTQTDYINA
SFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKCGQYWPLEK
DSRIRFGFLTVTNLGVENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYGVPSSAASL
IDFLRVVRNQQSMAVGNLGARSKGQCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGT
LNVFQTVSRMRTQRAFSIQTPEQYYFCYKAILEFAEREGMVPSGHSLLAMDGQ
Download sequence
Identical sequences O35239 Q2M4G8
ENSMUSP00000034832 ENSMUSP00000034832 NYSGXRC-13126a NYSGXRC-8607b ENSMUSP00000034832 10090.ENSMUSP00000034832 NP_062625.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]