SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_065204.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_065204.1.4139
Domain Number 1 Region: 180-250
Classification Level Classification E-value
Superfamily Homeodomain-like 6.84e-18
Family Homeodomain 0.0000547
Further Details:      
 
Domain Number 2 Region: 54-120
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.74e-16
Family LIM domain 0.022
Further Details:      
 
Domain Number 3 Region: 22-52
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000015
Family LIM domain 0.018
Further Details:      
 
Weak hits

Sequence:  NP_065204.1.4139
Domain Number - Region: 117-143
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00304
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_065204.1.4139
Sequence length 360
Comment insulin gene enhancer protein ISL-2 [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHAACLKCAECSQ
YLDETCTCFVRDGKTYCKRDYVRLFGIKCAQCQVGFSSSDLVMRARDSVYHIECFRCSVC
SRQLLPGDEFSLREHELLCRADHGLLLERAAAGSPRSPGPLPGTPPGLHLPDAGSGQQVS
LRTHVHKQAEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWF
QNKRCKDKKKSILMKQLQQQQHSDKASLQGLTGTLLVAGSPSAHENAVQGSAVEVQTYQP
PWKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVET
Download sequence
Identical sequences P50480
NP_065204.1.100692 NP_065204.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]