SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_065697.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_065697.1.92137
Domain Number 1 Region: 92-163
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.32e-17
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_065697.1.92137
Sequence length 181
Comment achaete-scute homolog 3 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MMDNRGNSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPS
DSLILGNYSEPCPFSFPMPYPNYRGCEYSYGPAFTRKRNERERQRVKCVNEGYAQLRHHL
PEEYLEKRLSKVETLRAAIKYINYLQSLLYPDKAETKNNPGKVSSMIATTSHHADPMFRI
V
Download sequence
Identical sequences 9606.ENSP00000318846 ENSP00000435770 ENSP00000318846 ENSP00000435770 NP_065697.1.87134 NP_065697.1.92137 gi|10190680|ref|NP_065697.1| NYSGRC-10190680 ENSP00000318846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]