SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_066972.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_066972.1.92137
Domain Number 1 Region: 2-141
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.86e-43
Family Cofilin-like 0.000000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_066972.1.92137
Sequence length 142
Comment coactosin-like protein [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFA
FVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKEL
EEDFIKSELKKAGGANYDAQTE
Download sequence
Identical sequences H2RA06 Q14019
NP_066972.1.87134 NP_066972.1.92137 XP_016785780.1.37143 d1wnja1 ENSP00000262428 ENSP00000262428 gi|21624607|ref|NP_066972.1| 9606.ENSP00000262428 ENSP00000262428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]