SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_066993.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_066993.1.87134
Domain Number 1 Region: 100-149
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000000392
Family Hairy Orange domain 0.0025
Further Details:      
 
Domain Number 2 Region: 25-94
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000432
Family HLH, helix-loop-helix DNA-binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_066993.1.87134
Sequence length 221
Comment transcription factor HES-4 isoform 2 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MAADTPGKPSASPMAGAPASASRTPDKPRSAAEHRKSSKPVMEKRRRARINESLAQLKTL
ILDALRKESSRHSKLEKADILEMTVRHLRSLRRVQVTAALSADPAVLGKYRAGFHECLAE
VNRFLAGCEGVPADVRSRLLGHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLP
SLGGPFPLLAPPLLPGLTRALPAAPRAGPQGPGGPWRPWLR
Download sequence
Identical sequences Q9HCC6
gi|10863967|ref|NP_066993.1| ENSP00000304595 ENSP00000304595 NP_066993.1.87134 NP_066993.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]