SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_067080.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_067080.1.92137
Domain Number 1 Region: 7-147
Classification Level Classification E-value
Superfamily Globin-like 8.44e-48
Family Globins 0.00000269
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_067080.1.92137
Sequence length 151
Comment neuroglobin [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPE
FLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKC
LGPAFTPATRAAWSQLYGAVVQAMSRGWDGE
Download sequence
Identical sequences A0A1K0FUC2 A0A2K5PS41 A0M8W9 G1S403 Q3KN66 Q9NPG2
ENSP00000298352 gi|10864065|ref|NP_067080.1| 9598.ENSPTRP00000011169 9606.ENSP00000298352 ENSNLEP00000020241 ENSNLEP00000020241 ENSPTRP00000011169 NP_001030585.1.37143 NP_067080.1.87134 NP_067080.1.92137 XP_003260844.1.23891 XP_003808912.1.60992 XP_017384045.1.71028 cath|current|4mpmA00/3-149 cath|current|4mpmB00/2-149 ENSP00000298352 ENSPTRP00000011169 4mpm_A 4mpm_B ENSP00000298352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]