SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_068577.2.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_068577.2.87134
Domain Number 1 Region: 160-308
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.7e-29
Family Toll/Interleukin receptor TIR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 8-103
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000406
Family I set domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_068577.2.87134
Sequence length 410
Comment single Ig IL-1-related receptor [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGG
HYSLHEYSWVKANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSHVA
AVLASLLVLLALLLAALLYVKCRLNVLLWYQDAYGEVEINDGKLYDAYVSYSDCPEDRKF
VNFILKPQLERRRGYKLFLDDRDLLPRAEPSADLLVNLSRCRRLIVVLSDAFLSRAWCSH
SFREGLCRLLELTRRPIFITFEGQRRDPAHPALRLLRQHRHLVTLLLWRPGSVTPSSDFW
KEVQLALPRKVQYRPVEGDPQTQLQDDKDPMLILRGRVPEGRALDSEVDPDPEGDLGVRG
PVFGEPSAPPHTSGVSLGESRSSEVDVSDLGSRNYSARTDFYCLVSKDDM
Download sequence
Identical sequences Q6IA17
gi|205277445|ref|NP_068577.2| gi|205277449|ref|NP_001128525.1| gi|205277451|ref|NP_001128526.1| 9606.ENSP00000333656 NP_001128525.1.87134 NP_001128525.1.92137 NP_001128526.1.87134 NP_001128526.1.92137 NP_068577.2.87134 NP_068577.2.92137 ENSP00000333656 ENSP00000380756 ENSP00000403104 ENSP00000333656 ENSP00000380756 ENSP00000403104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]