SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_071406.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_071406.1.87134
Domain Number 1 Region: 300-389
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.05e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00057
Further Details:      
 
Domain Number 2 Region: 126-178
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000644
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.027
Further Details:      
 
Domain Number 3 Region: 22-82
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000785
Family HLH, helix-loop-helix DNA-binding domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_071406.1.87134
Sequence length 901
Comment neuronal PAS domain-containing protein 3 isoform 2 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MAPTKPSFQQDPSRRERLQALRKEKSRDAARSRRGKENFEFYELAKLLPLPAAITSQLDK
ASIIRLTISYLKMRDFANQGDPPWNLRMEGPPPNTSVKGAQRRRSPSALAIEVFEAHLGS
HILQSLDGFVFALNQEGKFLYISETVSIYLGLSQVELTGSSVFDYVHPGDHVEMAEQLGM
KLPPGRGLLSQGTAEDGASSASSSSQSETPEPVESTSPSLLTTDNTLERSFFIRMKSTLT
KRGVHIKSSGYKVIHITGRLRLRVSLSHGRTVPSQIMGLVVVAHALPPPTINEVRIDCHM
FVTRVNMDLNIIYCENRISDYMDLTPVDIVGKRCYHFIHAEDVEGIRHSHLDLLNKGQCV
TKYYRWMQKNGGYIWIQSSATIAINAKNANEKNIIWVNYLLSNPEYKDTPMDIAQLPHLP
EKTSESSETSDSESDSKDTSGITEDNENSKSDEKGNQSENSEDPEPDRKKSGNACDNDMN
CNDDGHSSSNPDSRDSDDSFEHSDFENPKAGEDGFGALGAMQIKVERYVESESDLRLQNC
ESLTSDSAKDSDSAGEAGAQASSKHQKRKKRRKRQKGGSASRRRLSSASSPGGLDAGLVE
PPRLLSSPNSASVLKIKTEISEPINFDNDSSIWNYPPNREISRNESPYSMTKPPSSEHFP
SPQGGGGGGGGGGGLHVAIPDSVLTPPGADGAAARKTQFGASATAALAPVASDPLSPPLS
ASPRDKHPGNGGGGGGGGGGAGGGGPSASNSLLYTGDLEALQRLQAGNVVLPLVHRVTGT
LAATSTAAQRVYTTGTIRYAPAEVTLAMQSNLLPNAHAVNFVDVNSPGFGLDPKTPMEML
YHHVHRLNMSGPFGGAVSAASLTQMPAGNVFTTAEGLFSTLPFPVYSNGIHAAQTLERKE
D
Download sequence
Identical sequences ENSP00000319610 gi|11545847|ref|NP_071406.1| NP_071406.1.87134 NP_071406.1.92137 ENSP00000319610 9606.ENSP00000319610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]