SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_071605.2.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_071605.2.4139
Domain Number 1 Region: 219-284
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.42e-17
Family Complement control module/SCR domain 0.00014
Further Details:      
 
Domain Number 2 Region: 162-234
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.53e-16
Family Complement control module/SCR domain 0.00024
Further Details:      
 
Domain Number 3 Region: 36-101
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000027
Family Complement control module/SCR domain 0.00039
Further Details:      
 
Domain Number 4 Region: 97-172
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000144
Family Complement control module/SCR domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_071605.2.4139
Sequence length 399
Comment complement decay-accelerating factor precursor [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MIRTRAPGTRAPPPPPLLLSLSLLLLLLSPTVSGDCGPPPDIPNATPNSGKHTKFAHQSQ
VTYSCNKGFKQIPDKPNTVVCLENDQWSNYETFCNKTCSAPLRLNYASLKKEYRNMNFFP
IGTTVEFECRPGFQKVTSRTGKSTCLEELVWSPVVEFCKKRACPNPRELKNGHINIPTDI
LFGSEIIFSCDKGYKLVGVTSTFCSITGNAVDWDDVFPVCTTIFCPDPPKINNGRIREES
DSYAYRQSVTYSCDQGFILVGNSSVHCTLNGEVGEWSSAPPKCIERHKVPTKTPPEVDIP
STMPHESTLINFPSTRAPLSHKPTTVKVPGTRVKPTSHKPTEVKVPATQHVPVSKTTVRH
PTRTSKDRGESNSGGDHFIYGHTCLITMTILHVMLLLTG
Download sequence
Identical sequences Q9Z0M0
ENSRNOP00000005284 NP_071605.2.100692 NP_071605.2.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]