SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_077067.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_077067.1.4139
Domain Number 1 Region: 143-365
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.34e-55
Family C-terminal domain of adrenodoxin reductase-like 0.00000000489
Further Details:      
 
Domain Number 2 Region: 39-201
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 6.59e-19
Family N-terminal domain of adrenodoxin reductase-like 0.00000426
Further Details:      
 
Domain Number 3 Region: 343-493
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.000000718
Family N-terminal domain of adrenodoxin reductase-like 0.000000939
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_077067.1.4139
Sequence length 494
Comment NADPH:adrenodoxin oxidoreductase, mitochondrial precursor [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MAPRCWRWWSWSAWPGVRPLPSRSTPTPGFCKKFSTQETTPQICVVGSGPAGFYTAQHLL
KHHTRAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTARSDRCAFRGNVVVGRDV
SVPELREAYHAVVLSYGAEDHQPLEIPGEELPGVVSARAFVGWYNGLPENQKLAPDLSCD
TAVILGQGNVALDVARILLTPPEHLEKTDITEVALGVLRQSRVKTVWIVGRRGPLQVAFT
IKELREMIQLPGTQPILDPSDFLGLQDRIKDVPRPRKRLTELLLRTATEKPGVEEAARRA
LASRAWGLRFFRSPQQVLPTPDGRRVAGIRLAVTRLEGVGESTRAVPTGDVEDLPCGLLL
SSVGYKSRPIDPSVPFDPKLGIIPNTEGRVVNAPGLYCSGWVKRGPTGVITTTMTDSFLT
SQVLLKDLKAGLLPSGPRPGYTAIQALLSDRGVRPVSFSDWEKLDAEEVARGQGTGKPRE
KLVDRREMLQLLGH
Download sequence
Identical sequences P56522
ENSRNOP00000004592 NP_077067.1.100692 NP_077067.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]