SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_077195.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_077195.2.92730
Domain Number 1 Region: 41-216
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.21e-44
Family DnaQ-like 3'-5' exonuclease 0.00000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_077195.2.92730
Sequence length 237
Comment oligoribonuclease, mitochondrial precursor [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MLGVSLGARLLRGVGGRRGQFGARGVSEGSAAMAAGESMAQRMVWVDLEMTGLDIEKDQI
IEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCKEHHGKSGLTKAVKESTVTLQQA
EYEFLSFVRQQTPPGLCPLAGNSVHADKKFLDKHMPQFMKHLHYRIIDVSTVKELCRRWY
PEDYEFAPKKAASHRALDDISESIKELQFYRNNIFKKKTDEKKRKIIENGETEKPVS
Download sequence
Identical sequences Q9D8S4
NP_077195.2.92730 XP_021062408.1.100879 ENSMUSP00000034524 10090.ENSMUSP00000034524 ENSMUSP00000034524 ENSMUSP00000034524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]