SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_079484.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_079484.1.92137
Domain Number 1 Region: 61-169
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-24
Family Spermadhesin, CUB domain 0.00055
Further Details:      
 
Domain Number 2 Region: 256-362
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 9.3e-20
Family Platelet-derived growth factor-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_079484.1.92137
Sequence length 370
Comment platelet-derived growth factor D isoform 1 precursor [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MHRLIFVYTLICANFCSCRDTSATPQSASIKALRNANLRRDESNHLTDLYRRDETIQVKG
NGYVQSPRFPNSYPRNLLLTWRLHSQENTRIQLVFDNQFGLEEAENDICRYDFVEVEDIS
ETSTIIRGRWCGHKEVPPRIKSRTNQIKITFKSDDYFVAKPGFKIYYSLLEDFQPAAASE
TNWESVTSSISGVSYNSPSVTDPTLIADALDKKIAEFDTVEDLLKYFNPESWQEDLENMY
LDTPRYRGRSYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQ
RCGGNCGCGTVNWRSCTCNSGKTVKKYHEVLQFEPGHIKRRGRAKTMALVDIQLDHHERC
DCICSSRPPR
Download sequence
Identical sequences A0A2I3SLM0 G3QI67 Q9GZP0
NP_079484.1.87134 NP_079484.1.92137 XP_003828415.1.60992 XP_004052090.1.27298 XP_522165.2.37143 ENSP00000376865 9598.ENSPTRP00000007275 9606.ENSP00000376865 ENSPTRP00000007275 gi|13376808|ref|NP_079484.1| ENSGGOP00000002070 ENSP00000302193 ENSPTRP00000007275 ENSP00000376865 ENSGGOP00000002070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]