SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_079552.3.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_079552.3.92730
Domain Number 1 Region: 1741-1781,1819-2014
Classification Level Classification E-value
Superfamily Plakin repeat 4.01e-66
Family Plakin repeat 0.0000106
Further Details:      
 
Domain Number 2 Region: 1642-1769
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000000392
Family Plakin repeat 0.0093
Further Details:      
 
Domain Number 3 Region: 194-330
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000519
Family Spectrin repeat 0.003
Further Details:      
 
Weak hits

Sequence:  NP_079552.3.92730
Domain Number - Region: 585-717
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00504
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_079552.3.92730
Sequence length 2035
Comment envoplakin [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MFKGLSKGSQGKGSPKGSPAKGSPKGSPNKHNRAATQELALLISRMQANADQVERDILET
QKKLQQDRQNGEQNQALQHQQETGRNLKEAEVLLKDLFLDVDKARRLKHPQAEEIEKDIK
QLHERVTQECSEYRALYEKMVLPPDVGPRVDWARVLEQKQNLVREGHYGPGMAELEQQVA
EHNILQREIEAYGQQLRTLVGPDANTIRNQYRELLKAASWRRQSLGSLYTHLQGCTKQLS
ALADQQGRILQQDWSDLMPDPAGVRREYEHFKQHELLAQERSINQLEDDADRMVELGHPA
IGPIQVHQEALKMEWQNFLNLCICQESQLQRVEDYRRFQEEADSVSQTLAKLSSNLDTKY
GFGTGDSSGSPTELLLQLEAEEKQLAIAERAVGDLQQRSQEVAPLPQRRNPSKQPLHVDS
ICDWDSGEVQLLRGERYTLKDNADPYTWLVQGPGGETKSAPAACLCIPAPDPEAVAKASR
LATELQTLKQKLSTEKNRLKAAAVEHLQPGQQAPAGSAPADPQGQTLLSQMTQLDGDLGQ
IERQVLSWARSPLSQSSSLKDLEGRIHSCEGTAQRLQSLGAEKEAAQQECEAFLSTKPTG
SAALQLPVVLNSVKNRYNDVQSLCHLYGEKAKAALGLEKQIQEADRVIQGFEAALALEGP
VPEGSGALQERVSELQRQRKELLQQQACVLGLHRQLKATEHACSALQNNFQEFCQDLPRQ
QRQVRALTDRYHAVGDQLDLREKIVQDASLTYQQLRNSRDNLSSWLEQLPHHRVQPSDGP
SQISYKLQAQKRLIQEILGREQDQATVSRLTRDLQEALQDYELQADTYRCSLEPALAVSA
PKRLRVISLQESIQAQEKNLAKAYTEVAAAEQQQLRQLEFAKKMLRKKELDEDIQAIHSA
RQGSGSPAHARTAESEVLKTQLEEERKRVAEVQRDLEEQRQRLLQLRTQQPVARLEEKEV
VEFYRDPQLESNLSQAASRVEEEGKRRARLQAELEAVAQKVVHLEGKRKTMQPHLLTKEV
TQIERDPGLDSQVTQLHSEMQRLRGENGVLTARLEELKDELLALEQKEMNVKEKVVVKEV
VKVEKDLEMVKAAQTLRLQIEEDAARRKGAKETVAKIQARIKDLEQAISSVEPKVIVKEV
KKVEQDPGLLKEASRLRSLLEEEKNNNVALARELQELQEKYRVVEKQKPKVQLQERVSEI
FQVLPETEQEIRRLRAQLQETGSKKSGVEQEVEKLLPELEVLRAQKPVVEYKEVTQEVVR
HEKNPEVLREIDRLKAQLNELVNTNGRSQEQLIRLQGERDEWKRERSKVETKMVSKEVVR
HEKDPVLEKEAERLRQEVREAVQRRRATEDAVYELQNKLLLLERRRPEEQIVVQEVVVTQ
KDPKLREEHSRLSRSLDEEVGRRRQLELEVRQLGARVEEEEARLSFEEDRSKKLAAEREL
RQLTLKIQELEKRPPALQEKIIMEEVVKLEKDPDLERSTEALRRELDQEKNRVTELHREC
QGLQVQVDLLQKTKSQEKTIYKEVIRVEKDPVLEGERARVWEILNRERAARKGREEDVRS
LQERIDRAEALRRSWSREEAELQRARDQASQDCGRLQRQLRELEQQKQQKARQLQEEGRL
LSQKTESERQKAAQRSQAVTQLEAAILQEKDKIYEKERTLRDLHTKVSREELNQETQTRE
TNLSTKICILEPETGNDMSPYEAYKRGVIDRGQYLQLQELECDWEEVTTSSPCGEESVLL
DRKSGKQYSIEAALRCRRISKEEYHRYKDGRLPISEFALLVAGETKPSSSLSIGSIISKS
PVCSPGPQSTGFFSPGLSFGLTEDSFPIAGIYDTTTDNKCSIKAAVAKNMLDPITGQKLL
EAQAATGGIVDLLSRERYSVHKAVERGLIENTSTQRLLNAQKAFTGIEDPVTRKRLSVGE
AIQKGWMPQESVLPHLLVQHLTGGLIDPKRTGRIPVPQAVLCGMISEDLGQLLQDESGYE
KDLTDPITKERLSYKEAMGRCRKDPLSGLLLLPAMLEGYRCYRAASPTLPRSCVR
Download sequence
Identical sequences Q9D952
ENSMUSP00000037850 ENSMUSP00000037850 NP_079552.3.92730 10090.ENSMUSP00000037850 ENSMUSP00000037850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]