SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_080070.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_080070.2.92730
Domain Number 1 Region: 39-268,367-513
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.65e-65
Family FAD-linked reductases, N-terminal domain 0.00000000000533
Further Details:      
 
Domain Number 2 Region: 269-367
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.65e-37
Family Electron transfer flavoprotein-ubiquinone oxidoreductase-like 0.000000876
Further Details:      
 
Domain Number 3 Region: 515-614
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 9.01e-29
Family ETF-QO domain-like 0.00000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_080070.2.92730
Sequence length 616
Comment electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial precursor [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MLVRLTKLSCPAYHWFHALKIKKCLPLCAPRCSSTSAVPQITTHYTVHPREKDKRWEGVN
MERFAEEADVVIVGAGPAGLSAAIRLKQLAAEQGKDIRVCLVEKAAQIGAHTLSGACLDP
AAFKELFPDWKEKGAPLNTPVTEDRFAILTEKHRIPVPILPGLPMNNHGNYIVRLGHLVS
WMGEQAEALGVEVYPGYAAAEVLYHEDGSVKGIATNDVGIQKDGAPKTTFERGLELHAKV
TVFAEGCHGHLAKQLYKKFDLRASCDAQTYGIGLKELWIIDEKKWKPGRVDHTVGWPLDR
HTYGGSFLYHLNEGEPLVAVGFVVGLDYQNPYLSPFREFQRWKHHPSIQPTLEGGKRIAY
GARALNEGGLQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGSLAAESIFKQLTSE
NLQSKTTGLHVTEYEDNLKQSWVWKELHAVRNIRPSCHGILGVYGGMIYTGIFYWILRGM
EPWTLKHKGSDSDQLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTLKD
DSIPVNRNLSIYDGPEQRFCPAGVYEFVPLEQGDGFRLQINAQNCVHCKTCDIKDPSQNI
NWVVPEGGGGPAYNGM
Download sequence
Identical sequences Q921G7
ENSMUSP00000029386 10090.ENSMUSP00000029386 NP_080070.2.92730 ENSMUSP00000029386 ENSMUSP00000029386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]