SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_081978.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_081978.1.92730
Domain Number 1 Region: 70-170
Classification Level Classification E-value
Superfamily Ras GEF 0.00000000000000131
Family Ras GEF 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_081978.1.92730
Sequence length 214
Comment uncharacterized protein LOC71162 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MFRCFQTCRGSGHKKAKSSWLGCFWRRLIRPLTHLRHASRSEPKVCCENEQEPDSMSNHP
RFDYKSREYIQQMIDYIPAAIQNRDHLCLDIFVAMYRTYATTWEVLDLLMKTYASFRTDC
IEDQQTKSAIFSFLFGWFQKFPQDFYESPDLAVLSQFTEYVRLNVPFGDGDTQAREPLSM
FKDQEAITLRLEEGEKVWCWLLDKVGGGFGDGFH
Download sequence
Identical sequences Q9D420
NP_081978.1.92730 ENSMUSP00000032648 ENSMUSP00000032648 10090.ENSMUSP00000032648 ENSMUSP00000032648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]