SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_082116.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_082116.1.92730
Domain Number 1 Region: 56-186
Classification Level Classification E-value
Superfamily PX domain 5.1e-25
Family PX domain 0.0039
Further Details:      
 
Domain Number 2 Region: 189-284
Classification Level Classification E-value
Superfamily TPR-like 0.00005
Family Tetratricopeptide repeat (TPR) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_082116.1.92730
Sequence length 313
Comment sorting nexin-20 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MASPEHPGSPGWRGPINQCRTRTRQEVLPPGPDLPCPGPEEAQDGPSSNSSMTTRELQEH
WQKEKSRWKHVRLLFEIASARIEERKVSKFVMYQVVVIQTGSFDSDKAVVERRYSDFERL
QKALLKRFGPELEDVAFPRKRLTGNLSAETICERRRELREYLRLLYAVRAVRRSREFLDF
LTRPELREAFGCLRAGQYARALELLGRALPLQEKLTAHCPSAAVPALCAALVCLRDLERP
AEAFAVGERALRCLRTRENHRYYAPLLDAMVRLAYALGKDFAALQSRLDENQLRRPTHRD
ATLKELTVREYLS
Download sequence
Identical sequences A0A0R4J0D0
ENSMUSP00000034087 NP_082116.1.92730 XP_006531434.1.92730 ENSMUSP00000034087 ENSMUSP00000034087 10090.ENSMUSP00000034087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]