SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_082844.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_082844.1.92730
Domain Number 1 Region: 18-163
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.98e-39
Family Dual specificity phosphatase-like 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_082844.1.92730
Sequence length 189
Comment dual specificity phosphatase 21 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MTTASCIFPSQATQQDNIYGLSQITASLFISNSAVANDKLTLSNNHITTIINVSAEVVNT
FFEDIQYVQVPVSDAPNSYLYDFFDPIADHIHGVEMRNGRTLLHCAAGVSRSATLCLAYL
MKYHNMTLLDAHTWTKTCRPIIRPNNGFWEQLIHYEFKLFSRNTVRMIYSPIGLIPNIYE
KEAYLMELM
Download sequence
Identical sequences Q9D9D8
NP_082844.1.92730 ENSMUSP00000026018 10090.ENSMUSP00000026018 ENSMUSP00000026018 ENSMUSP00000026018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]