SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_084182.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_084182.2.92730
Domain Number 1 Region: 22-150
Classification Level Classification E-value
Superfamily Lysozyme-like 1.23e-48
Family C-type lysozyme 0.00000434
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_084182.2.92730
Sequence length 151
Comment lysozyme C-like precursor [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MKAPLTLLTLGLLLLSITIQGKVYDRCSLARTLQSLGLAGFQGITLANWVCLAKWESNFN
TNTTRFNPEDQSTSYGIFQINSRFWCNDGKTPGSRNFCRISCKALLKSNIWSAVVCAKRI
VKDPQGIYSWAGWIKHCKNKNLKEYIRGCHL
Download sequence
Identical sequences Q8BM26
ENSMUSP00000020392 10090.ENSMUSP00000020392 NP_084182.2.92730 ENSMUSP00000020392 ENSMUSP00000125436 ENSMUSP00000020392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]