SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_110437.2.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_110437.2.92137
Domain Number 1 Region: 186-294
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.06e-33
Family PDI-like 0.0074
Further Details:      
 
Domain Number 2 Region: 320-427
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.53e-33
Family PDI-like 0.0044
Further Details:      
 
Domain Number 3 Region: 64-168
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.27e-30
Family PDI-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_110437.2.92137
Sequence length 432
Comment thioredoxin domain-containing protein 5 isoform 1 precursor [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MPARPGRLLPLLARPAALTALLLLLLGHGGGGRWGARAQEAAAAAADGPPAADGEDGQDP
HSKHLYTADMFTHGIQSAAHFVMFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVD
CTAHSDVCSAQGVRGYPTLKLFKPGQEAVKYQGPRDFQTLENWMLQTLNEEPVTPEPEVE
PPSAPELKQGLYELSASNFELHVAQGDHFIKFFAPWCGHCKALAPTWEQLALGLEHSETV
KIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTETG
ATETVTPSEAPVLAAEPEADKGTVLALTENNFDDTIAEGITFIKFYAPWCGHCKTLAPTW
EELSKKEFPGLAGVKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSL
HRFVLSQAKDEL
Download sequence
Identical sequences Q8NBS9
ENSP00000369081 gi|42794771|ref|NP_110437.2| NP_110437.2.87134 NP_110437.2.92137 ENSP00000369081 9606.ENSP00000369081 ENSP00000369081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]