SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_114467.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_114467.1.4139
Domain Number 1 Region: 223-400
Classification Level Classification E-value
Superfamily MIR domain 2.09e-48
Family MIR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 1087-1200
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.7e-17
Family SPRY domain 0.031
Further Details:      
 
Domain Number 3 Region: 3995-4073
Classification Level Classification E-value
Superfamily EF-hand 0.00000000077
Family Calmodulin-like 0.051
Further Details:      
 
Domain Number 4 Region: 665-813
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000633
Family SPRY domain 0.052
Further Details:      
 
Domain Number 5 Region: 107-188
Classification Level Classification E-value
Superfamily MIR domain 0.00000275
Family MIR domain 0.021
Further Details:      
 
Domain Number 6 Region: 442-554
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000929
Family IP3 receptor type 1 binding core, domain 2 0.02
Further Details:      
 
Domain Number 7 Region: 2150-2215
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000981
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_114467.1.4139
Sequence length 4953
Comment ryanodine receptor 2 isoform 1 [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MADAGEGEDEIQFLRTDDEVVLQCTATIHKEQQKLCLAAGGFGNRLCFLESTSNSKNVPP
DLSICTFVLEQSLSVRALQEMLANTVEKSEGKFMMKTAQGGGHRTLLYGHAILLRHSYSG
MYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVS
SERYLHLSYGNSSWRVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGHMDECLTV
PSGEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHVTTGKYLS
LMEDKNLLLMDKEKADVKSTAFAFRSSKEKLDAGVRKEVDGMGTSEIKYGDSICYIQHVD
TGLRLTYQAVDVKSARMGSIQRKAIMHHEGHMDDGLNLSRSQHEESRTARVIRSTVFLFN
RFIRGLDALSKRAKLPTVDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLRALKNRQN
LFQEEGMINLVLECIDRLHVYSSAAHFADVAGREAGESWKSILNSLYELLAALIRGNRKN
CAQFSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISLLDKHGRN
HKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIFLGVSEGS
AQYKKWYYELMVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGDDLFSYGF
DGLHLWSGCIARTVSSPNQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFENFNIDGL
FFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAACYEAVLPKEKLKVEHSREYKQERTYT
RDLLGPTVSLTQAAFTPVPVDTSQIVLPPHLERIRERLAENIHELWVMNKIELGWQYGPV
RDDNKRQHPCLVEFCKLPEQERNYNLQMSLETLKTLLALGCHVGIADEHAEEKVKKMKLP
KNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNR
RNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYHLEAPDQDHASRAEVCSGTGERFRI
FRAEKTYAVKAGRWYFEFEAVTAGDMRVGWSRPGCQPDLELGSDERAFAFDGFKAQRWHQ
GNEHYGRSWQAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKDFDVGDGFIPVCSL
GVAQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQVPSNHEH
IEVTRIDGTIDSSPCLKVTQKSFGSQNSNTDIMFYRLSMPIECAEVFSKSVAGGIPGAGF
YGPKNDLEDFDVDSDFEVLMKTAHGHLVPDRMDKDKETPKPEFNNHKDYAQEKPSRLKQR
FLLRRTKPDYSTSHSARLTEDVLADDRDDYEYLMQTSTYYYSVRIFPGQEPANVWVGWIT
SDFHQYDTGFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESMSPGQGRNNSNGLE
IGCVVDAASGLLTFIANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRIKNVMPL
SAGLFKSEHKNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQCLDPLQ
FMSLHIPEENRSVDILELTEQEELLQFHYHTLRLYSAVCALGNHRVAHALCSHVDEPQLL
YAIENKYMPGLLRAGYYDLLIDIHLSSYATARLMMNNEFIVPMTEETKSITLFPDENKKH
GLPGIGLSTSLRPRMCFSSPSFVSISNECYQYSPEFPLDILKAKTIQMLTEAVKEGSLHA
RDPVGGTTEFLFVPLIKLFYTLLIMGIFHNEDLKHILRLIEPSVFKEAATPEEEGGAPEK
EISIDDSKLEVKEEAKAGKRPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRHRIEAIVAF
SDDFVAKLQDNQRFRYNEVMQALNMSAALTARKEFRSPPQEQINMLLNFKDDKSECPCPE
EIRDQLLDFHEDLMTHCGIELDEDGSLDGSNDLTIRGRLLSLVEKVTYLKKKQAEKPVAS
DSRKSSSLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVRALPKTYTING
VSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNLMRALGMHET
VMEVMVNVLGGGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLA
SPAMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQMLVSKGYPDIGW
NPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGGNGLLAAMEEA
IKIAEDPSRDGPSPTSGSSKTLDAEEEEDDTIHMGNAIMTFYAALIDLLGRCAPEMHLIH
AGKGEAIRIRSILRSLIPLGDLVGVISIAFQMPTIAKDGKVVEPDMSAGFCPDHKAAMVL
FLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTAVLPLLTR
CAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLRPSMMQHLLR
RLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWSNFGAASEEELHLSRKLFWGIFD
ALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVSMMEKQSSMDSEGNSNPQPVDTSN
ITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKIQPLMKPYKLLSEKEKEI
YRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSIDAAHGYSPRAIDMSN
VTLSRDLHAMAEMMAENYHNIWAKKKKMELESKGGGNHPLLVPYDTLTAKEKAKDREKAQ
DIFKFLQISGYAVSRGFKDLDLDTPSIEKRFAYSFLQQLIRYVDEAHQYILEFDGGSRSK
GEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCTGGHASNKEKEMVTSLFCK
LGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMKTGLDSVKSALRAFLDNAAEDLEK
TMENLKQGQFTHTRSQPKGVTQIINYTTVALLPMLSSLFEHIGQHQFGEDLILEDVQVSC
YRILTSLYALGTSKSIYVERQRSALGECLAAFAGAFPIAFLETHLDKHNVYSIYNTRSSR
ERAALSLPANVEDVCPNIPSLEKLMTEIIELAESGTRYTQMPHMMGVVLPMLCSYMSRWW
EHGPENHPERAEMCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLAVFSQPIINKV
KPQLLKTHFLPLMEKLKKKAAMVVSEEDHLKAEARGDMSEAELLILDEFTTLARNLYAFY
PLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIYWSKSHNFKREEQNFVVQNEINNMSF
LITDTKSKMSKAAISDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNICAPGDQELIA
LAKNRFSLKDTEEEVRDVIRSNIHLQGKLEDPAIRWQMALYKDLPNRAEDTSDPERTVER
ILDIANVLFHLEQVEHPQRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRAVNLFLQ
GYEKSWIETEEHYFEDKLIEDLAKPGSELPEEDEAMKRVDPLHQLILLFSRTALTEKCKL
EEDFLYMAYADIMAKSCHDEEDDDGEEEVKSFEVTGSQRSKEKEMEKQKLLYQQARLHDR
GAAEMVLQTFSASKGETGPMVAATLKLGIATLNGGNSTVQQKMLDYLKEKKDVGFFQSLA
GLMQSCSVLDLNAFERQNKAEGLGMVTEEGSGEKVLQDDEFTCDLFRFLQLLCEGHNSDF
QNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDIIGEQGQRNFSKAIQVAK
QVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIELLKELMDL
QKDMVVMLLSMLEGNVVNGTIGKQMVDMLAESSNNVEMILKFFDMFLKLKDLTSSDTFKE
YDPDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRFHEPAKDI
GFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRIEIMGSAKRIERVYFEISE
SSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAAQISESGLNER
SANKEESEKERPEEQAPRMGFFSLLTVQSALFALRYNVLTLVRMLSLKSLKKQMKRMKKM
TAKDMVSAFFSSYWSVFVTLLHFVASVCRGFFRIVSSLLLGGSLVEGAKKIKVAELLANM
PDPTQDEVRGDEEEGERKPLESALPSEDLTDLKELTEESDLLSDIFGLDLKREGGQYKLI
PHNPNAGLSDLMTNPIPVPEVQEKFQEQKVKEEKEGKEETKSEPEKAEGEDGEKEEKAKD
DKGKQKLRQLHTHRYGEPEVPESAFWKKIIAYQQKLLNYFARNFYNMRMLALFVAFAINF
ILLFYKVSTSSVVEGKELPTRTSSDAAKVTTSLDSGPHRIIAVHYVLEESSGYMEPTLRI
LAILHTIISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSEDDIKGQWDRLV
INTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDFSGAREKKKPKKDSSL
SAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFFAAHLLDIAMGFKTLR
TILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDTPDMKCDDMLTCYM
FHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGLIIDAFGELR
DQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINKDETEHT
GQESYVWKMHQERCWEFFPAGDCFRKQYEDQLN
Download sequence
Identical sequences NP_114467.1.100692 NP_114467.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]