SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_115488.2.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_115488.2.87134
Domain Number 1 Region: 25-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.8e-19
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_115488.2.87134
Sequence length 159
Comment 39S ribosomal protein L43, mitochondrial isoform a [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MTARGTPSRFLASVLHNGLGRYVQQLQRLSFSVSRDGASSRGAREFVEREVIDFARRNPG
VVIYVNSRPCCVPRVVAEYLNGAVREESIHCKSVEEISTLVQKLADQSGLDVIRIRKPFH
TDNPSIQGQWHPFTNKPTTFRGLRPREVQDPAPAQVQAQ
Download sequence
Identical sequences K7AAG0
ENSPTRP00000055035 gi|28872734|ref|NP_115488.2| ENSP00000315948 ENSP00000359256 NP_115488.2.87134 NP_115488.2.92137 XP_005270288.1.92137 XP_006718098.1.92137 XP_016774629.1.37143 XP_018890126.1.27298 ENSP00000315948 ENSP00000359256 ENSPTRP00000055035 hsi002025749.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]