SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_115570.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_115570.1.92137
Domain Number - Region: 81-227
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.000392
Family Brix domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_115570.1.92137
Sequence length 306
Comment ribosome production factor 2 homolog isoform 1 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MDTLDRVVKPKTKRAKRFLEKREPKLNENIKNAMLIKGGNANATVTKVLKDVYALKKPYG
VLYKKKNITRPFEDQTSLEFFSKKSDCSLFMFGSHNKKRPNNLVIGRMYDYHVLDMIELG
IENFVSLKDIKNSKCPEGTKPMLIFAGDDFDVTEDYRRLKSLLIDFFRGPTVSNIRLAGL
EYVLHFTALNGKIYFRSYKLLLKKSGCRTPRIELEEMGPSLDLVLRRTHLASDDLYKLSM
KMPKALKPKKKKNISHDTFGTTYGRIHMQKQDLSKLQTRKMKGLKKRPAERITEDHEKKS
KRIKKN
Download sequence
Identical sequences A0A2I3RSJ1 Q9H7B2
9598.ENSPTRP00000031600 9606.ENSP00000402338 GO.34769 Hs20551627___KOG3031 NP_115570.1.87134 NP_115570.1.92137 XP_001156493.1.37143 XP_003822251.1.60992 ENSPTRP00000031600 ENSP00000402338 ENSP00000402338 ENSP00000357857 gi|39930469|ref|NP_115570.1| ENSPTRP00000031600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]