SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_116120.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_116120.1.92137
Domain Number 1 Region: 3-119
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.83e-29
Family Txnl5-like 0.00000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_116120.1.92137
Sequence length 123
Comment thioredoxin domain-containing protein 17 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHI
SEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLF
SED
Download sequence
Identical sequences A0A140VJY7 A0A2I3H5Q4 G3QKM5 H2QC11 Q9BRA2
gi|14249348|ref|NP_116120.1| 1wouA 1wou_A 9598.ENSPTRP00000014752 9606.ENSP00000250101 NP_116120.1.87134 NP_116120.1.92137 XP_003274631.1.23891 XP_003810187.1.60992 XP_004058471.1.27298 XP_511988.2.37143 ENSNLEP00000011250 ENSP00000250101 ENSPTRP00000014752 cath|current|1wouA00/4-122 ENSPTRP00000014752 ENSP00000250101 ENSP00000250101 ENSNLEP00000011250 ENSGGOP00000003003 ENSGGOP00000003003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]