SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_172519.1.80155 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_172519.1.80155
Domain Number - Region: 218-322,369-402
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00109
Family Tandem AAA-ATPase domain 0.053
Further Details:      
 
Domain Number - Region: 610-642
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0208
Family N-acetyl transferase, NAT 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_172519.1.80155
Sequence length 1028
Comment GNAT acetyltransferase (DUF699) [Arabidopsis thaliana]; AA=GCF_000001735.3; RF=reference genome; TAX=3702; STAX=3702; NAME=Arabidopsis thaliana; ecotype=Columbia; AL=Chromosome; RT=Major
Sequence
MRKKVDERIRTLIENGVKLRHRSMFVIIGDKARDQIVNLHHILSKSVVKSNPSVLWCYKN
RLDISSHNKKRAKQLKKMKERGQLDPEKLDAFSLFLDVVDVTHCLYKDSERILGNTFGIC
ILQDFEALTPNLLARTIETVEGGGLVVLLLQSLASLTSLCTMVMDVHDRFRTESHSEASG
RFNERFLLSLASCKACVVMDDELNLLPLSSHIKSITKVPTKEDSEALSEAERDLKSLKDA
LNDDFPVGPLINKCCTLDQGKAVVTFFDAILDKTLRSIVALIASRGRGKSAALGLAVAGA
VAAGYSNIYVTAPSPDNLKTVFEFVCKGFDALEYKEHLEYDVVRSVNPEFNKAIVRINIF
KQHRQTIQYIQPHEHEKLSQVELLVIDEAAAIPLPVVKSLLGPYLVFLSSTVSGYEGTGR
SLSLKLLQQLEEQSRAPVTGVEGSLSGCLFKKIELSESIRYASGDPIESWLNGLLCLDVA
NCLPNPACHPLPSQCDLYYVNRDTLFSYHKDSELFLQRMMALCVSSHYKNSPNDLQLLSD
APAHHLFVLLGPVDESKNQLPDILCVIQVCLEGQISRKSAEKSLREGHSPHGDQIPWKFC
EQFRDVVFPKLSGARIVRIAVHPNAMKMGYGSAAVELLTRYFEGQLASISEGDDELEVEP
SPVRVTEAAAKVSLLEEQIKPRANLPPLLVPLRDRRPERLHYIGVSFGLTLDLFRFWRKH
KFAPFYISQIPSAVTGEHTCMLLKPLTLSNDEFEVDESDELGFFAPFYKDFRIRFSKLLS
DKFKKMDYKLAMSVLNPKINFPEVDLTGNSPDGFLKKLDGVLSPYDMERFRAYTANLVDF
NLVYDICKTLAHHYFQEKLPVSLSYVQASVLLCLGLQESDFSSIERQMQLERGQIYSLLL
KVGKKLYKYLNGIATKELESTLPRLKDRVLEPHKVSVDEDLREGAKEVEEQMRARIEELL
DPELLDQFAIGDKEAEALQKSKISSSGLISIESTKTDNKKEKPSGFDKSAKKRGNDKHSS
TSNKKRRA
Download sequence
Identical sequences Q9XIK4
At1g10490___KOG2036 NP_001318971.1.80155 NP_172519.1.80155 AT1G10490.1 3702.AT1G10490.1-P AT1G10490.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]