SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_173547.1.80155 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_173547.1.80155
Domain Number 1 Region: 397-686
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.13e-75
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 288-332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000121
Family EGF-type module 0.027
Further Details:      
 
Weak hits

Sequence:  NP_173547.1.80155
Domain Number - Region: 257-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00629
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_173547.1.80155
Sequence length 741
Comment wall associated kinase 3 [Arabidopsis thaliana]; AA=GCF_000001735.3; RF=reference genome; TAX=3702; STAX=3702; NAME=Arabidopsis thaliana; ecotype=Columbia; AL=Chromosome; RT=Major
Sequence
MKFQEGVFLVVIFFLAYTQLVKGQHQPREDCKLKCGNVTIEYPFGISTGCYYPGDDNFNL
TCVVEEKLLLFGIIQVTNISHSGHVSVLFERFSECYEQKNETNGTALGYQLGSSFSLSSN
NKFTLVGCNALSLLSTFGKQNYSTGCLSLCNSQPEANGRCNGVGCCTTEDFSVPFDSDTF
QFGSVRLRNQVNNSLDLFNTSVYQFNPCTYAFLVEDGKFNFDSSKDLKNLRNVTRFPVAL
DWSIGNQTCEQAGSTRICGKNSSCYNSTTRNGYICKCNEGYDGNPYRSEGCKDIDECISD
THNCSDPKTCRNRDGGFDCKCPSGYDLNSSMSCTRPEYKRTRIFLVIIIGVLVLLLAAIC
IQHATKQRKYTKLRRQFFEQNGGGMLIQRLSGAGLSNIDFKIFTEEGMKEATNGYDESRI
LGQGGQGTVYKGILPDNTIVAIKKARLADSRQVDQFIHEVLVLSQINHRNVVKILGCCLE
TEVPLLVYEFITNGTLFDHLHGSIFDSSLTWEHRLRIAIEVAGTLAYLHSSASIPIIHRD
IKTANILLDENLTAKVADFGASKLIPMDKEQLTTMVQGTLGYLDPEYYTTGLLNEKSDVY
SFGVVLMELLSGQKALCFERPQASKHLVSYFVSATEENRLHEIIDDQVLNEDNLKEIQEA
ARIAAECTRLMGEERPRMKEVAAKLEALRVEKTKHKWSDQYPEENEHLIGGHILSAQGET
SSSIGYDSIKNVAILDIETGR
Download sequence
Identical sequences Q9LMN8
AT1G21240.1 NP_173547.1.80155 3702.AT1G21240.1-P AT1G21240.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]