SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_174138.1.80155 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_174138.1.80155
Domain Number 1 Region: 38-96
Classification Level Classification E-value
Superfamily DNA-binding domain 3.14e-21
Family GCC-box binding domain 0.00023
Further Details:      
 
Weak hits

Sequence:  NP_174138.1.80155
Domain Number - Region: 111-174
Classification Level Classification E-value
Superfamily BT0923-like 0.00523
Family BT0923-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_174138.1.80155
Sequence length 245
Comment Integrase-type DNA-binding superfamily protein [Arabidopsis thaliana]; AA=GCF_000001735.3; RF=reference genome; TAX=3702; STAX=3702; NAME=Arabidopsis thaliana; ecotype=Columbia; AL=Chromosome; RT=Major
Sequence
MEFNGNLNAGSCSRSKKSHRQKQQQPQPQPQQHIEEIKYVGVRRRPWGRYAAEIRNPTTK
ERYWLGTFDTAEEAALAYDRAARSIRGLTARTNFVYSDMPRGSSVTSFVSPDESQRFISE
LFNPPSQLEATNSNNNNNNNLYSSTNNQNQNSIEFSYNGWPQEAECGYQSITSNAEHCDH
ELPPLPPSTCFGAELRIPETDSYWNVAHASIDTFAFELDGFVDQNSLGQSGTEGFNSLPS
TFFYQ
Download sequence
Identical sequences Q9FZ90
AT1G28160.1 AT1G28160.1 3702.AT1G28160.1-P NP_174138.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]