SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_177348.1.80155 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_177348.1.80155
Domain Number 1 Region: 72-254
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000000000833
Family N-acetyl transferase, NAT 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_177348.1.80155
Sequence length 256
Comment Acyl-CoA N-acyltransferases (NAT) superfamily protein [Arabidopsis thaliana]; AA=GCF_000001735.3; RF=reference genome; TAX=3702; STAX=3702; NAME=Arabidopsis thaliana; ecotype=Columbia; AL=Chromosome; RT=Major
Sequence
MGHLPQSLYSAAGPKFPYPGSSGLGVDQRKLTWSRFPVFLRCASTESLTSLTQNNAAEIE
LKYLVSQHGWDVRRLNRDDEDEIRRVSLVQAEAFHIPLALFDDFFFMFFQAEVLSALLYK
LKNSPPDRYACLVAEQTSETETLSSSSVVGVVDVTAQTESSVLRYFPGVEEYLYVSGLAV
SKSQRRKKMASTLLKACDVLCYLWGFKLLALRAYEDDAAARNLYSNAGYSVVETDPLWTS
TWIGRKRRVLMSKRFS
Download sequence
Identical sequences Q9C7G6
AT1G72030.1 3702.AT1G72030.1-P NP_177348.1.80155 AT1G72030.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]