SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_179875.2.80155 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_179875.2.80155
Domain Number 1 Region: 75-311
Classification Level Classification E-value
Superfamily Carbamate kinase-like 4.34e-41
Family N-acetyl-l-glutamate kinase 0.00076
Further Details:      
 
Domain Number 2 Region: 449-598
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.22e-22
Family N-acetyl transferase, NAT 0.025
Further Details:      
 
Domain Number 3 Region: 394-442
Classification Level Classification E-value
Superfamily Carbamate kinase-like 0.0000000354
Family N-acetyl-l-glutamate kinase 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_179875.2.80155
Sequence length 609
Comment N-acetyl-l-glutamate synthase 1 [Arabidopsis thaliana]; AA=GCF_000001735.3; RF=reference genome; TAX=3702; STAX=3702; NAME=Arabidopsis thaliana; ecotype=Columbia; AL=Chromosome; RT=Major
Sequence
MTERGAMVVSSSTCYVPFRCPQARKDFAFVEPSKKLNPNRVLIKPPVYTYSPALTAAKCN
IFDYAETGENLVGDKQFVRWFREAWPYLWAHRSCTFVVTISGDVLDGPYCDLVLKDIAFL
HHLGIKFVLVPGTQVQIDQLLAERGREPTYVGRYRVTDSASLQAAKEAAGAISVMIEAKL
SPGPSIYNIRRHGDSSRLHETGVRVDTGNFFAAKRRGVVDGVDFGATGLVKKIDVDRIRE
RLDSGSVVLLRNLGHSSTGEVLNCNTYEVATACALAIGADKLICIMDGPVLDENGHLVRF
LTLQEADTLVRKRAQQSEIAANYVKAVGDGGISSFPEPLGYNGMVTTPNNHIGRPIWEKL
SPTFQNGVGFDNGNGLWSGEQGFAIGGEERISRLNGYLSELAAAAFVCRGGVKRVHLLDG
TISGVLLLELFKRDGMGTMVASDVYEGNREAKVEDLAGIRQIIKPLEESGALVRRTDEEL
LRALDSFVVVEREGHIIACAALFPFFEEKCGEVAAIAVASDCRGQGQGDKLLDYIEKKAS
ALGLEMLFLLTTRTADWFVRRGFQECPIEMIPEARRERINLSRRSKYYMKKLLPDRSGIS
VVRTFQYDS
Download sequence
Identical sequences Q84JF4
NP_179875.2.80155 AT2G22910.1 AT2G22910.1 3702.AT2G22910.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]