SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_181348.1.80155 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_181348.1.80155
Domain Number 1 Region: 22-165
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.61e-30
Family N-acetyl transferase, NAT 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_181348.1.80155
Sequence length 190
Comment Acyl-CoA N-acyltransferases (NAT) superfamily protein [Arabidopsis thaliana]; AA=GCF_000001735.3; RF=reference genome; TAX=3702; STAX=3702; NAME=Arabidopsis thaliana; ecotype=Columbia; AL=Chromosome; RT=Major
Sequence
MEKEMEDKEEFDEGEIEYTSYAGEHHLPLIMSLVDQELSEPYSIFTYRYFVYLWPQLCFL
AFHKGKCVGTIVCKMGDHRQTFRGYIAMLVVIKPYRGRGIASELVTRAIKAMMESGCEEV
TLEAEVSNKGALALYGRLGFIRAKRLYHYYLNGMDAFRLKLLFPKPRVPQIPSQVQTQQE
YETFPRPRVP
Download sequence
Identical sequences O80438
NP_181348.1.80155 NP_973629.1.80155 AT2G38130.1 AT2G38130.2 AT2G38130.1 3702.AT2G38130.2-P GO.11625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]