SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_194640.1.80155 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_194640.1.80155
Domain Number - Region: 90-122
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0981
Family GCC-box binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_194640.1.80155
Sequence length 200
Comment cotton fiber protein [Arabidopsis thaliana]; AA=GCF_000001735.3; RF=reference genome; TAX=3702; STAX=3702; NAME=Arabidopsis thaliana; ecotype=Columbia; AL=Chromosome; RT=Major
Sequence
MESSVPKRGLYMEMEQNAQVAAKRLWKVVRIVFCVLKTGTVKNKLMLDLNLMLKRGNKAI
TNLRRRSSSTGSHDVSSSSRVRDYDPFAFISKRKRRVHGGYDNEEDAVEAAVKKVFELLG
ENDKKTVATESARESPLIMSPAVRQLRVTDSPFPLDDGGDHDHVVDKAAEEFIKKFYKNL
KLQKKMTNALESPYHDGWVR
Download sequence
Identical sequences A0A178V0H4 Q9SZE0
AT4G29110.1 NP_194640.1.80155 AT4G29110.1 3702.AT4G29110.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]