SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_201519.1.80155 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_201519.1.80155
Domain Number 1 Region: 187-246
Classification Level Classification E-value
Superfamily DNA-binding domain 5.49e-17
Family GCC-box binding domain 0.0019
Further Details:      
 
Domain Number 2 Region: 95-153
Classification Level Classification E-value
Superfamily DNA-binding domain 3.99e-16
Family GCC-box binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_201519.1.80155
Sequence length 352
Comment target of early activation tagged (EAT) 3 [Arabidopsis thaliana]; AA=GCF_000001735.3; RF=reference genome; TAX=3702; STAX=3702; NAME=Arabidopsis thaliana; ecotype=Columbia; AL=Chromosome; RT=Major
Sequence
MWNLNDSPDHHEESDSRGNPVGHVSNGMSQSATWLPFVLPVTRNFFPAQSMEPGVRWSGF
NSVGKSDPSGSGRPEEPEISPPIKKSRRGPRSRSSQYRGVTFYRRTGRWESHIWDCGKQV
YLGGFDTAHAAARAYDRAAIKFRGVDADINFDIEDYLDDLKQMGNLTKEEFMHVLRRQST
GFPRGSSKYRGVTLHKCGRWESRLGQFLNKKYVYLGLFDTEIEAARAYDKAAIKCNGKDA
VTNFDPKVYEEEEDLSSETTRNGHNLGLSLGESSSEEFRLKSDIASIRSRIRDEERLLGS
DLSLAMMTTTVRSEKQQSDGGGNRVVGMAASSGFSPQPSPYRIPRTFHFSRP
Download sequence
Identical sequences Q9FH95
AT5G67180.1 NP_201519.1.80155 3702.AT5G67180.1-P AT5G67180.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]