SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_277042.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_277042.1.92137
Domain Number 1 Region: 220-460
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.66e-82
Family Hexokinase 0.00000000058
Further Details:      
 
Domain Number 2 Region: 9-218
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.3e-76
Family Hexokinase 0.00000000496
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_277042.1.92137
Sequence length 466
Comment glucokinase isoform 2 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MAMDVTRSQAQTALTLVEQILAEFQLQEEDLKKVMRRMQKEMDRGLRLETHEEASVKMLP
TYVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTA
EMLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGN
NVVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHQCEVGMIVGTGCNACYMEEMQ
NVELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRLVDESSANPGQQLYEKLIGGKYMG
ELVRLVLLRLVDENLLFHGEASEQLRTRGAFETRFVSQVESDTGDRKQIYNILSTLGLRP
STTDCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSF
KERFHASVRRLTPSCEITFIESEEGSGRGAALVSAVACKKACMLGQ
Download sequence
Identical sequences A0A2J8L9I2
NP_277042.1.87134 NP_277042.1.92137 XP_003805279.1.60992 ENSP00000384247 gi|15967159|ref|NP_277042.1| 9606.ENSP00000223366 ENSP00000223366 ENSP00000223366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]