SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_277048.2.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_277048.2.87134
Domain Number 1 Region: 36-74
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000131
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_277048.2.87134
Sequence length 290
Comment tubulin polyglutamylase complex subunit 1 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MAAVEKRRQAVPPPAGFTDSGRQSVSRAAGAAESEEDFLRQVGVTEMLRAALLKVLEARP
EEPIAFLAHYFENMGLRSPVNGGAGEPPGQLLLQQQRLGRALWHLRLAHHSQRAAFNNNV
SVAYECLSAGGRRKRPGLDGRTYSELLRRICRDGQAPEEVVAPLLRKVQCRDHEAVPLSV
FRAGTLTCFVLLEFVARAGALFQLLEDSAAAVADRRVGQAVLDTLEGALQASDAAAPARF
LEAGSRLGPDSLALALDRAVGGRRPSAPMTREEFLERAAALFIAKVKPVG
Download sequence
Identical sequences Q6ZTW0
ENSP00000352265 ENSP00000352265 gi|123173766|ref|NP_277048.2| ENSP00000352265 NP_277048.2.87134 NP_277048.2.92137 9606.ENSP00000352265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]