SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_348496.1.94244 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_348496.1.94244
Domain Number - Region: 7-77
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0183
Family BAR domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_348496.1.94244
Sequence length 362
Comment replication initiation protein REP [Clostridium acetobutylicum ATCC 824]; AA=GCF_000008765.1; RF=reference genome; TAX=272562; STAX=1488; NAME=Clostridium acetobutylicum ATCC 824; strain=ATCC 824; AL=Complete Genome; RT=Major
Sequence
MDFENETLEKMEQKRIDYNRKYANWYKQMSKDMQQEKHLAYAETLKKKGERIKSCMNIWL
WDIYRKNKLLDLQKVNRCMNNRFCPNCRKFNLSCAIHNLKKPLNDLLLDGYYPYLVTLTI
PNVLGKELKRTIEKMNKAFKKLFGAYSYDLQGKTTKGFKDRLICFEGALKVLEITYNEES
NTYHPHFHCLFFSQQYDQELFIKNTPGEFSNKRNSYNFYSLLDIQIMKLWTMYFKEIRVN
EKNYNNTKLQDCFICDIREMDSAGIVEVLKYTFKDTDIKSYDVFKNIELAISNKRIRQGY
GILYNLKLEDDADGEKLSLEEFLNESEVPSLLVVREIKELLTSYRDYKKISRSKVHEDII
KI
Download sequence
Identical sequences Q97HY4
272562.CA_C1872 gi|15895147|ref|NP_348496.1| NP_348496.1.94244 WP_010965177.1.17575 WP_010965177.1.17905 WP_010965177.1.48544 WP_010965177.1.57811 WP_010965177.1.71350 WP_010965177.1.92914 gi|384458597|ref|YP_005671017.1| gi|337737089|ref|YP_004636536.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]