SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_446061.2.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_446061.2.4139
Domain Number 1 Region: 8-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.24e-21
Family Ubiquitin-related 0.0000244
Further Details:      
 
Domain Number 2 Region: 671-681,802-840
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000445
Family Formin homology 2 domain (FH2 domain) 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_446061.2.4139
Sequence length 1096
Comment large proline-rich protein BAG6 isoform 2 [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MEPSDSTSTAMEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLI
YQGRVLQDDKKLQDYNVGGKVIHLVERAPPQTQLPSGASSGTGSASATHGGGPLPGTRGP
GASGHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLL
SRMECRGGTQAQASQPPPQTPTVASETVALNSQTSEPVESEAPPREPMESEEMEERPPTQ
TPELPPSGPAPAGPAPAPETNAPNHPSPAEHVEVLQELQRLQRRLQPFLQRYCEVLGAAA
TTDYNNNHEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACAPPRHLHVVRPMSHYT
TPMVLQQAAIPIQINVGTTVTMTGNGARPPPAPGAEAASPGSGQASSLPPSSATVDSSTE
GAPPPGPAPPPATSHPRVIRISHQSVEPVVMMHMNIQDSGAQPGGVPSAPTGPLGPPGHG
QSLGQQVPGFPTAPTRVVIARPTPPQARPSHPGGPPVSGALGAGLGTNTSLAQMVSGLVG
QLLMQPVLVAQGTPGMAPASASAPATAQAQAPAPAPAPAPAPATASASAGTTNTATTAGP
APGGPAQPPPPQPSAADLQFSQLLGNLLGPAGPGAGGPSLASPTITVAVPGVPAFLQGMT
EFLQASQAAPPPPPPPPPPPPAPEQQTTPPPGSPSGGTASPGGLGPESLPPEFFTSVVQG
VLSSLLGSLGARAGSSESIAAFIQRLSGSSNIFEPGADGALGFFGALLSLLCQNFSMVDV
VMLLHGHFQPLQRLQPQLRSFFHQHYLGGQEPTSSNIRMATHTLITGLEEYVRESFSLVQ
VQPGVDIIRTNLEFLQEQFNSIAAHVLHCTDSGFGARLLELCNQGLFECLALNLHCLGGQ
QMELAAVINGRIRRMSRGVNPSLVSWLTTMMGLRLQVVLEHMPVGPDAILRYVRRIGDPP
QALPEEPMEVQGAERTSPEPQREDASPAPGTTAEEAMSRGPPPAPEGGSRDEQDGASADA
EPWAAAVPPEWVPIIQQDIQSQRKVKPQPPLSDAYLSGMPAKRRKLRSDIQKRLQEDPNY
SPQRFPNAHRAFADDP
Download sequence
Identical sequences ENSRNOP00000001129 NP_446061.2.100692 NP_446061.2.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]